Lineage for d1r4fb1 (1r4f B:2-327)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136733Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2136734Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2136735Family c.70.1.1: Nucleoside hydrolase [53591] (5 protein domains)
    automatically mapped to Pfam PF01156
  6. 2136736Protein Inosine-adenosine-guanosine preferring nucleoside hydrolase [69587] (1 species)
  7. 2136737Species Trypanosoma vivax [TaxId:5699] [69588] (5 PDB entries)
  8. 2136747Domain d1r4fb1: 1r4f B:2-327 [96995]
    Other proteins in same PDB: d1r4fa2, d1r4fb2
    complexed with ad3, ca; mutant

Details for d1r4fb1

PDB Entry: 1r4f (more details), 2.3 Å

PDB Description: Inosine-Adenosine-Guanosine Preferring Nucleoside Hydrolase From Trypanosoma vivax: Trp260Ala Mutant In Complex With 3-Deaza-Adenosine
PDB Compounds: (B:) IAG-nucleoside hydrolase

SCOPe Domain Sequences for d1r4fb1:

Sequence, based on SEQRES records: (download)

>d1r4fb1 c.70.1.1 (B:2-327) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax [TaxId: 5699]}
aknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm
nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll
adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg
taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm
wamcthcellrdgdgyyaadaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaen
ypltfvarnpeaeffldmllrsarac

Sequence, based on observed residues (ATOM records): (download)

>d1r4fb1 c.70.1.1 (B:2-327) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax [TaxId: 5699]}
aknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm
nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll
adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg
taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm
wamyaadaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfvarnpeae
ffldmllrsarac

SCOPe Domain Coordinates for d1r4fb1:

Click to download the PDB-style file with coordinates for d1r4fb1.
(The format of our PDB-style files is described here.)

Timeline for d1r4fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r4fb2