Lineage for d1r4ac_ (1r4a C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866676Protein ADP-ribosylation factor [52614] (17 species)
  7. 2866721Species Human (Homo sapiens), ARL1 [TaxId:9606] [102364] (4 PDB entries)
  8. 2866728Domain d1r4ac_: 1r4a C: [96988]
    Other proteins in same PDB: d1r4ae_, d1r4af_, d1r4ag_, d1r4ah_
    complexed with gnp, mg

Details for d1r4ac_

PDB Entry: 1r4a (more details), 2.3 Å

PDB Description: Crystal Structure of GTP-bound ADP-ribosylation Factor Like Protein 1 (Arl1) and GRIP Domain of Golgin245 COMPLEX
PDB Compounds: (C:) ADP-ribosylation factor-like protein 1

SCOPe Domain Sequences for d1r4ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4ac_ c.37.1.8 (C:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}
remrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggqtsir
pywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqamt
psemanalglpalkdrkwqifktsatkgtgldeamewlvetlksr

SCOPe Domain Coordinates for d1r4ac_:

Click to download the PDB-style file with coordinates for d1r4ac_.
(The format of our PDB-style files is described here.)

Timeline for d1r4ac_: