Lineage for d1r49a3 (1r49 A:202-430)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1453404Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily)
    2 domains: alpha+beta and all-beta
  4. 1453405Superfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) (S)
    automatically mapped to Pfam PF02919
  5. 1453406Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein)
  6. 1453407Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species)
  7. 1453410Species Human (Homo sapiens) [TaxId:9606] [56744] (15 PDB entries)
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 1453425Domain d1r49a3: 1r49 A:202-430 [96985]
    Other proteins in same PDB: d1r49a1, d1r49a2
    protein/DNA complex; mutant

Details for d1r49a3

PDB Entry: 1r49 (more details), 3.13 Å

PDB Description: human topoisomerase i (topo70) double mutant k532r/y723f
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1r49a3:

Sequence, based on SEQRES records: (download)

>d1r49a3 e.15.1.1 (A:202-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
kwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffa
kmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmsk
eeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimped
iiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimln

Sequence, based on observed residues (ATOM records): (download)

>d1r49a3 e.15.1.1 (A:202-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
kwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffa
kmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmsk
eeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimped
iiincsdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimln

SCOPe Domain Coordinates for d1r49a3:

Click to download the PDB-style file with coordinates for d1r49a3.
(The format of our PDB-style files is described here.)

Timeline for d1r49a3: