SCOP 1.73: Domain d1r47b1: 1r47 B:324-422

Lineage for d1r47b1 (1r47 B:324-422)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Melibiase [75020] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101919] (2 PDB entries)
   alpha-galactosidase A

8. Domain d1r47b1: 1r47 B:324-422 [96979]
   Other proteins in same PDB: d1r47a2, d1r47b2
   complexed with egl, fuc, gal, man, nag

Details for d1r47b1

PDB Entry: 1r47, 3.45 Å

PDB Description: structure of human alpha-galactosidase

PDB Compounds: (B:) Alpha-galactosidase A

SCOP Domain Sequences for d1r47b1:

Sequence; same for both SEQRES and ATOM records:

>d1r47b1 b.71.1.1 (B:324-422) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentmq

Timeline for d1r47b1:

• d1r47b1 first appeared in SCOP 1.67
  
• d1r47b1 appears in SCOP 1.71
  
• d1r47b1 appears in SCOP 1.75
  
• d1r47b1 appears in the current release, SCOPe 2.08