SCOPe 2.05: Domain d1r47a1: 1r47 A:324-421

Lineage for d1r47a1 (1r47 A:324-421)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Melibiase [75020] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101919] (17 PDB entries)
   alpha-galactosidase A

8. Domain d1r47a1: 1r47 A:324-421 [96977]
   Other proteins in same PDB: d1r47a2, d1r47b2
   complexed with edo, gal

Details for d1r47a1

PDB Entry: 1r47, 3.45 Å

PDB Description: structure of human alpha-galactosidase

PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d1r47a1:

Sequence; same for both SEQRES and ATOM records:

>d1r47a1 b.71.1.1 (A:324-421) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentm

Timeline for d1r47a1:

• d1r47a1 first appeared in SCOP 1.67
  
• d1r47a1 appears in SCOPe 2.04
  
• d1r47a1 appears in SCOPe 2.06
  
• d1r47a1 appears in the current release, SCOPe 2.08