Lineage for d1r43b1 (1r43 B:24-247,B:364-455)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889724Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)
  6. 2889819Protein Peptidase-like beta-alanine synthase, catalytic domain [102507] (1 species)
  7. 2889820Species Yeast (Saccharomyces kluyveri) [TaxId:4934] [102508] (2 PDB entries)
  8. 2889830Domain d1r43b1: 1r43 B:24-247,B:364-455 [96971]
    Other proteins in same PDB: d1r43a2, d1r43b2
    complexed with bib, dtt, trs, zn

Details for d1r43b1

PDB Entry: 1r43 (more details), 2.8 Å

PDB Description: Crystal structure of beta-alanine synthase from Saccharomyces kluyveri (selenomethionine substituted protein)
PDB Compounds: (B:) beta-alanine synthase

SCOPe Domain Sequences for d1r43b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r43b1 c.56.5.4 (B:24-247,B:364-455) Peptidase-like beta-alanine synthase, catalytic domain {Yeast (Saccharomyces kluyveri) [TaxId: 4934]}
aaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwftneces
lgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevlrtfkdn
nyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesvydslkn
igyigdtpasykeneidahfelhieqgpiledenkaigivtgvqXavnfhevciecvsrs
afaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfkv
llqaiinydnyrvirgh

SCOPe Domain Coordinates for d1r43b1:

Click to download the PDB-style file with coordinates for d1r43b1.
(The format of our PDB-style files is described here.)

Timeline for d1r43b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r43b2