SCOPe 2.08: Domain d1r43a2: 1r43 A:248-363

Lineage for d1r43a2 (1r43 A:248-363)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family)

5. Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)

6. Protein Peptidase-like beta-alanine synthase [103003] (1 species)

7. Species Yeast (Saccharomyces kluyveri) [TaxId:4934] [103004] (2 PDB entries)

8. Domain d1r43a2: 1r43 A:248-363 [96970]
   Other proteins in same PDB: d1r43a1, d1r43b1
   complexed with bib, dtt, trs, zn

Details for d1r43a2

PDB Entry: 1r43, 2.8 Å

PDB Description: Crystal structure of beta-alanine synthase from Saccharomyces kluyveri (selenomethionine substituted protein)

PDB Compounds: (A:) beta-alanine synthase

SCOPe Domain Sequences for d1r43a2:

Sequence; same for both SEQRES and ATOM records:

>d1r43a2 d.58.19.1 (A:248-363) Peptidase-like beta-alanine synthase {Yeast (Saccharomyces kluyveri) [TaxId: 4934]}
aynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpys
vniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvsp

Timeline for d1r43a2:

• d1r43a2 first appeared in SCOP 1.67
  
• d1r43a2 appears in SCOPe 2.07