Lineage for d1r3ra_ (1r3r A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840547Superfamily c.1.22: UROD/MetE-like [51726] (3 families) (S)
  5. 2840548Family c.1.22.1: Uroporphyrinogen decarboxylase, UROD [51727] (2 proteins)
    automatically mapped to Pfam PF01208
  6. 2840549Protein Uroporphyrinogen decarboxylase, UROD [51728] (3 species)
  7. 2840550Species Human (Homo sapiens) [TaxId:9606] [51729] (19 PDB entries)
  8. 2840551Domain d1r3ra_: 1r3r A: [96962]
    mutant

Details for d1r3ra_

PDB Entry: 1r3r (more details), 1.85 Å

PDB Description: uroporphyrinogen decarboxylase with mutation d86n
PDB Compounds: (A:) Uroporphyrinogen decarboxylase

SCOPe Domain Sequences for d1r3ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3ra_ c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD {Human (Homo sapiens) [TaxId: 9606]}
fpelkndtflraawgeetdytpvwcmrqagrylpefretraaqdffstcrspeacceltl
qplrrfpldaaiifsnilvvpqalgmevtmvpgkgpsfpeplreeqdlerlrdpevvase
lgyvfqaitltrqrlagrvpligfagapwtlmtymvegggsstmaqakrwlyqrpqashq
llriltdalvpylvgqvvagaqalqlfeshaghlgpqlfnkfalpyirdvakqvkarlre
aglapvpmiifakdghfaleelaqagyevvgldwtvapkkarecvgktvtlqgnldpcal
yaseeeigqlvkqmlddfgphryianlghglypdmdpehvgafvdavhkhsrllrq

SCOPe Domain Coordinates for d1r3ra_:

Click to download the PDB-style file with coordinates for d1r3ra_.
(The format of our PDB-style files is described here.)

Timeline for d1r3ra_: