Lineage for d1r3nh1 (1r3n H:18-247,H:364-455)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398073Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 398389Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 398477Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (9 proteins)
  6. 398514Protein Peptidase-like beta-alanine synthase, catalytic domain [102507] (1 species)
  7. 398515Species Yeast (Saccharomyces kluyveri) [TaxId:4934] [102508] (2 PDB entries)
  8. 398523Domain d1r3nh1: 1r3n H:18-247,H:364-455 [96959]
    Other proteins in same PDB: d1r3na2, d1r3nb2, d1r3nc2, d1r3nd2, d1r3ne2, d1r3nf2, d1r3ng2, d1r3nh2
    complexed with bib, zn

Details for d1r3nh1

PDB Entry: 1r3n (more details), 2.7 Å

PDB Description: Crystal structure of beta-alanine synthase from Saccharomyces kluyveri

SCOP Domain Sequences for d1r3nh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3nh1 c.56.5.4 (H:18-247,H:364-455) Peptidase-like beta-alanine synthase, catalytic domain {Yeast (Saccharomyces kluyveri)}
gtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwf
tneceslgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevl
rtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesv
ydslknigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqXavnfhevci
ecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeei
engfkvllqaiinydnyrvirgh

SCOP Domain Coordinates for d1r3nh1:

Click to download the PDB-style file with coordinates for d1r3nh1.
(The format of our PDB-style files is described here.)

Timeline for d1r3nh1: