![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins) |
![]() | Protein Peptidase-like beta-alanine synthase, catalytic domain [102507] (1 species) |
![]() | Species Yeast (Saccharomyces kluyveri) [TaxId:4934] [102508] (2 PDB entries) |
![]() | Domain d1r3nh1: 1r3n H:18-247,H:364-455 [96959] Other proteins in same PDB: d1r3na2, d1r3nb2, d1r3nc2, d1r3nd2, d1r3ne2, d1r3nf2, d1r3ng2, d1r3nh2 complexed with bib, zn |
PDB Entry: 1r3n (more details), 2.7 Å
SCOPe Domain Sequences for d1r3nh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r3nh1 c.56.5.4 (H:18-247,H:364-455) Peptidase-like beta-alanine synthase, catalytic domain {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} gtlnlpaaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwf tneceslgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevl rtfkdnnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesv ydslknigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqXavnfhevci ecvsrsafaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeei engfkvllqaiinydnyrvirgh
Timeline for d1r3nh1: