Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) |
Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (6 proteins) |
Protein Peptidase-like beta-alanine synthase [103003] (1 species) |
Species Yeast (Saccharomyces kluyveri) [TaxId:4934] [103004] (2 PDB entries) |
Domain d1r3ng2: 1r3n G:248-363 [96958] Other proteins in same PDB: d1r3na1, d1r3nb1, d1r3nc1, d1r3nd1, d1r3ne1, d1r3nf1, d1r3ng1, d1r3nh1 |
PDB Entry: 1r3n (more details), 2.7 Å
SCOP Domain Sequences for d1r3ng2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r3ng2 d.58.19.1 (G:248-363) Peptidase-like beta-alanine synthase {Yeast (Saccharomyces kluyveri)} aynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpys vniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvsp
Timeline for d1r3ng2: