Lineage for d1r3ne1 (1r3n E:23-247,E:364-455)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 837609Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 838036Superfamily c.56.5: Zn-dependent exopeptidases [53187] (9 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 838193Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)
  6. 838290Protein Peptidase-like beta-alanine synthase, catalytic domain [102507] (1 species)
  7. 838291Species Yeast (Saccharomyces kluyveri) [TaxId:4934] [102508] (2 PDB entries)
  8. 838296Domain d1r3ne1: 1r3n E:23-247,E:364-455 [96953]
    Other proteins in same PDB: d1r3na2, d1r3nb2, d1r3nc2, d1r3nd2, d1r3ne2, d1r3nf2, d1r3ng2, d1r3nh2

Details for d1r3ne1

PDB Entry: 1r3n (more details), 2.7 Å

PDB Description: Crystal structure of beta-alanine synthase from Saccharomyces kluyveri
PDB Compounds: (E:) beta-alanine synthase

SCOP Domain Sequences for d1r3ne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3ne1 c.56.5.4 (E:23-247,E:364-455) Peptidase-like beta-alanine synthase, catalytic domain {Yeast (Saccharomyces kluyveri) [TaxId: 4934]}
paaaplsiasgrlnqtiletgsqfggvarwgqeshefgmrrlagtaldgamrdwftnece
slgckvkvdkignmfavypgknggkptatgshldtqpeagkydgilgvlaglevlrtfkd
nnyvpnydvcvvvwfneegarfarsctgssvwshdlsleeayglmsvgedkpesvydslk
nigyigdtpasykeneidahfelhieqgpiledenkaigivtgvqXavnfhevciecvsr
safaqfkkdqvrqiwsgaghdscqtaphvptsmifipskdglshnyyeysspeeiengfk
vllqaiinydnyrvirgh

SCOP Domain Coordinates for d1r3ne1:

Click to download the PDB-style file with coordinates for d1r3ne1.
(The format of our PDB-style files is described here.)

Timeline for d1r3ne1: