SCOP 1.71: Domain d1r3lb1: 1r3l B:1-118

Lineage for d1r3lb1 (1r3l B:1-118)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1r3lb1: 1r3l B:1-118 [96940]
   Other proteins in same PDB: d1r3la1, d1r3la2, d1r3lb2, d1r3lc_
   part of Fab against potassium channel KcsA
   complexed with cs, dga, f09; mutant

Details for d1r3lb1

PDB Entry: 1r3l, 2.41 Å

PDB Description: potassium channel kcsa-fab complex in cs+

SCOP Domain Sequences for d1r3lb1:

Sequence; same for both SEQRES and ATOM records:

>d1r3lb1 b.1.1.1 (B:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvss

Timeline for d1r3lb1:

• d1r3lb1 first appeared in SCOP 1.67
  
• d1r3lb1 appears in SCOP 1.69
  
• d1r3lb1 appears in SCOP 1.73
  
• d1r3lb1 appears in the current release, SCOPe 2.08