Lineage for d1r3la2 (1r3l A:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2749038Species Mouse (Mus musculus) [TaxId:10090] [88567] (374 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2749193Domain d1r3la2: 1r3l A:108-212 [96939]
    Other proteins in same PDB: d1r3la1, d1r3lb1, d1r3lb2, d1r3lb3, d1r3lc_
    part of Fab against potassium channel KcsA
    complexed with cs, dga, f09

Details for d1r3la2

PDB Entry: 1r3l (more details), 2.41 Å

PDB Description: potassium channel kcsa-fab complex in cs+
PDB Compounds: (A:) antibody fab fragment light chain

SCOPe Domain Sequences for d1r3la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3la2 b.1.1.2 (A:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d1r3la2:

Click to download the PDB-style file with coordinates for d1r3la2.
(The format of our PDB-style files is described here.)

Timeline for d1r3la2: