![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) ![]() |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein Potassium channel protein [56901] (2 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [56902] (18 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
![]() | Domain d1r3kc_: 1r3k C: [96937] Other proteins in same PDB: d1r3ka1, d1r3ka2, d1r3kb1, d1r3kb2 complexed with dga, tl |
PDB Entry: 1r3k (more details), 2.8 Å
SCOPe Domain Sequences for d1r3kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r3kc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d1r3kc_:
![]() Domains from other chains: (mouse over for more information) d1r3ka1, d1r3ka2, d1r3kb1, d1r3kb2 |