Lineage for d1r3kc_ (1r3k C:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 425916Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 425917Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 425918Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins)
  6. 425927Protein Potassium channel protein [56901] (1 species)
  7. 425928Species Streptomyces lividans [TaxId:1916] [56902] (12 PDB entries)
  8. 425934Domain d1r3kc_: 1r3k C: [96937]
    Other proteins in same PDB: d1r3ka1, d1r3ka2, d1r3kb1, d1r3kb2
    complexed with dga, tl; mutant

Details for d1r3kc_

PDB Entry: 1r3k (more details), 2.8 Å

PDB Description: potassium channel KcsA-Fab complex in low concentration of Tl+

SCOP Domain Sequences for d1r3kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3kc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOP Domain Coordinates for d1r3kc_:

Click to download the PDB-style file with coordinates for d1r3kc_.
(The format of our PDB-style files is described here.)

Timeline for d1r3kc_: