Lineage for d1r3kb2 (1r3k B:119-219)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2022294Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 2022610Species Mouse (Mus musculus) [TaxId:10090] [88576] (424 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 2023023Domain d1r3kb2: 1r3k B:119-219 [96936]
    Other proteins in same PDB: d1r3ka1, d1r3ka2, d1r3kb1, d1r3kc_
    part of Fab against potassium channel KcsA
    complexed with dga, tl

Details for d1r3kb2

PDB Entry: 1r3k (more details), 2.8 Å

PDB Description: potassium channel KcsA-Fab complex in low concentration of Tl+
PDB Compounds: (B:) antibody fab fragment heavy chain

SCOPe Domain Sequences for d1r3kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3kb2 b.1.1.2 (B:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivprd

SCOPe Domain Coordinates for d1r3kb2:

Click to download the PDB-style file with coordinates for d1r3kb2.
(The format of our PDB-style files is described here.)

Timeline for d1r3kb2: