SCOP 1.73: Domain d1r3ka1: 1r3k A:1-107

Lineage for d1r3ka1 (1r3k A:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1r3ka1: 1r3k A:1-107 [96933]
   Other proteins in same PDB: d1r3ka2, d1r3kb1, d1r3kb2, d1r3kc_
   part of Fab against potassium channel KcsA
   complexed with dga, tl; mutant

Details for d1r3ka1

PDB Entry: 1r3k, 2.8 Å

PDB Description: potassium channel kcsa-fab complex in low concentration of tl+

PDB Compounds: (A:) antibody fab fragment light chain

SCOP Domain Sequences for d1r3ka1:

Sequence; same for both SEQRES and ATOM records:

>d1r3ka1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik

Timeline for d1r3ka1:

• d1r3ka1 first appeared in SCOP 1.67
  
• d1r3ka1 appears in SCOP 1.71
  
• d1r3ka1 appears in SCOP 1.75
  
• d1r3ka1 appears in the current release, SCOPe 2.08