Lineage for d1r3jc_ (1r3j C:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629055Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2629056Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2629057Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2629078Protein Potassium channel protein [56901] (3 species)
  7. 2629081Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 2629082Domain d1r3jc_: 1r3j C: [96932]
    Other proteins in same PDB: d1r3ja1, d1r3ja2, d1r3jb1, d1r3jb2, d1r3jb3
    complexed with dga, f09, tl

Details for d1r3jc_

PDB Entry: 1r3j (more details), 1.9 Å

PDB Description: potassium channel kcsa-fab complex in high concentration of tl+
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1r3jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d1r3jc_:

Click to download the PDB-style file with coordinates for d1r3jc_.
(The format of our PDB-style files is described here.)

Timeline for d1r3jc_: