Lineage for d1r3jc_ (1r3j C:)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745164Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 745165Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 745166Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)
  6. 745181Protein Potassium channel protein [56901] (1 species)
  7. 745182Species Streptomyces coelicolor [TaxId:1902] [56902] (27 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
  8. 745183Domain d1r3jc_: 1r3j C: [96932]
    Other proteins in same PDB: d1r3ja1, d1r3ja2, d1r3jb1, d1r3jb2
    complexed with dga, f09, tl; mutant

Details for d1r3jc_

PDB Entry: 1r3j (more details), 1.9 Å

PDB Description: potassium channel KcsA-Fab complex in high concentration of Tl+
PDB Compounds: (C:) Voltage-gated potassium channel

SCOP Domain Sequences for d1r3jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOP Domain Coordinates for d1r3jc_:

Click to download the PDB-style file with coordinates for d1r3jc_.
(The format of our PDB-style files is described here.)

Timeline for d1r3jc_: