SCOP 1.67: Domain d1r3il1: 1r3i L:1-107

Lineage for d1r3il1 (1r3i L:1-107)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)

8. Domain d1r3il1: 1r3i L:1-107 [96926]
   Other proteins in same PDB: d1r3ic_, d1r3ih1, d1r3ih2, d1r3il2
   part of Fab against potassium channel KcsA
   complexed with dga, f09, rb; mutant

Details for d1r3il1

PDB Entry: 1r3i, 2.4 Å

PDB Description: potassium channel kcsa-fab complex in rb+

SCOP Domain Sequences for d1r3il1:

Sequence; same for both SEQRES and ATOM records:

>d1r3il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik

Timeline for d1r3il1:

• d1r3il1 is new in SCOP 1.67
  
• d1r3il1 appears in SCOP 1.69
  
• d1r3il1 appears in the current release, SCOPe 2.08