Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) Pfam PF00520 |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (3 species) |
Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
Domain d1r3ic_: 1r3i C: [96923] Other proteins in same PDB: d1r3ih1, d1r3ih2, d1r3ih3, d1r3il1, d1r3il2 complexed with dga, f09, rb |
PDB Entry: 1r3i (more details), 2.4 Å
SCOPe Domain Sequences for d1r3ic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r3ic_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d1r3ic_: