SCOP 1.71: Domain d1r3ic_: 1r3i C:

Lineage for d1r3ic_ (1r3i C:)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)

6. Protein Potassium channel protein [56901] (1 species)

7. Species Streptomyces coelicolor and Streptomyces lividans [56902] (13 PDB entries)

8. Domain d1r3ic_: 1r3i C: [96923]
   Other proteins in same PDB: d1r3ih1, d1r3ih2, d1r3il1, d1r3il2
   complexed with dga, f09, rb; mutant

Details for d1r3ic_

PDB Entry: 1r3i, 2.4 Å

PDB Description: potassium channel KcsA-Fab complex in Rb+

SCOP Domain Sequences for d1r3ic_:

Sequence; same for both SEQRES and ATOM records:

>d1r3ic_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor and Streptomyces lividans}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d1r3ic_:

• d1r3ic_ first appeared in SCOP 1.67
  
• d1r3ic_ appears in SCOP 1.69
  
• d1r3ic_ appears in SCOP 1.73
  
• d1r3ic_ appears in the current release, SCOPe 2.07