Lineage for d1r3ic_ (1r3i C:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519626Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 519627Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 519628Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins)
  6. 519637Protein Potassium channel protein [56901] (1 species)
  7. 519638Species Streptomyces coelicolor and Streptomyces lividans [56902] (13 PDB entries)
  8. 519643Domain d1r3ic_: 1r3i C: [96923]
    Other proteins in same PDB: d1r3ih1, d1r3ih2, d1r3il1, d1r3il2

Details for d1r3ic_

PDB Entry: 1r3i (more details), 2.4 Å

PDB Description: potassium channel KcsA-Fab complex in Rb+

SCOP Domain Sequences for d1r3ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3ic_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor and Streptomyces lividans}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOP Domain Coordinates for d1r3ic_:

Click to download the PDB-style file with coordinates for d1r3ic_.
(The format of our PDB-style files is described here.)

Timeline for d1r3ic_: