Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (185 PDB entries) Uniprot P61769 21-119 Uniprot P01884 Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d1r3hf_: 1r3h F: [96919] Other proteins in same PDB: d1r3ha1, d1r3ha2, d1r3hc1, d1r3hc2, d1r3he1, d1r3he2, d1r3hg1, d1r3hg2 |
PDB Entry: 1r3h (more details), 2.5 Å
SCOP Domain Sequences for d1r3hf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r3hf_ b.1.1.2 (F:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1r3hf_: