Lineage for d1r3he2 (1r3h E:5001-5180)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501126Protein Class I MHC homolog [54489] (4 species)
    gamma, delta T-cell ligand
  7. 501132Species Mouse (Mus musculus), t10 [TaxId:10090] [102839] (1 PDB entry)
  8. 501135Domain d1r3he2: 1r3h E:5001-5180 [96918]
    Other proteins in same PDB: d1r3ha1, d1r3hb_, d1r3hc1, d1r3hd_, d1r3he1, d1r3hf_, d1r3hg1, d1r3hh_

Details for d1r3he2

PDB Entry: 1r3h (more details), 2.5 Å

PDB Description: Crystal Structure of T10

SCOP Domain Sequences for d1r3he2:

Sequence, based on SEQRES records: (download)

>d1r3he2 d.19.1.1 (E:5001-5180) Class I MHC homolog {Mouse (Mus musculus), t10}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeaddweqq
thivtiqgqlsernlmtlvhfynksmddshtlqwlqdcdvepdrhlclwynqlaydsedl
ptlsenpssctvgnstvpqisqhleghcsdvlqkylekgkerll

Sequence, based on observed residues (ATOM records): (download)

>d1r3he2 d.19.1.1 (E:5001-5180) Class I MHC homolog {Mouse (Mus musculus), t10}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeaddweqq
thivtiqgqlsernlmtlvhfynksmddshtlqwlqdcdvepdrhlclwynqlaydsedl
ptlsenpssctqhleghcsdvlqkylekgkerll

SCOP Domain Coordinates for d1r3he2:

Click to download the PDB-style file with coordinates for d1r3he2.
(The format of our PDB-style files is described here.)

Timeline for d1r3he2: