SCOPe 2.08: Domain d1r3he2: 1r3h E:5001-5180

Lineage for d1r3he2 (1r3h E:5001-5180)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC homolog [54489] (4 species)
   gamma, delta T-cell ligand

7. Species Mouse (Mus musculus), t10 [TaxId:10090] [102839] (1 PDB entry)

8. Domain d1r3he2: 1r3h E:5001-5180 [96918]
   Other proteins in same PDB: d1r3ha1, d1r3hb_, d1r3hc1, d1r3hd_, d1r3he1, d1r3hf_, d1r3hg1, d1r3hh_

Details for d1r3he2

PDB Entry: 1r3h, 2.5 Å

PDB Description: Crystal Structure of T10

PDB Compounds: (E:) MHC h2-tl-t10-129

SCOPe Domain Sequences for d1r3he2:

Sequence, based on SEQRES records:

>d1r3he2 d.19.1.1 (E:5001-5180) Class I MHC homolog {Mouse (Mus musculus), t10 [TaxId: 10090]}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeaddweqq
thivtiqgqlsernlmtlvhfynksmddshtlqwlqdcdvepdrhlclwynqlaydsedl
ptlsenpssctvgnstvpqisqhleghcsdvlqkylekgkerll

Sequence, based on observed residues (ATOM records):

>d1r3he2 d.19.1.1 (E:5001-5180) Class I MHC homolog {Mouse (Mus musculus), t10 [TaxId: 10090]}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeaddweqq
thivtiqgqlsernlmtlvhfynksmddshtlqwlqdcdvepdrhlclwynqlaydsedl
ptlsenpssctqhleghcsdvlqkylekgkerll

Timeline for d1r3he2:

• d1r3he2 first appeared in SCOP 1.67
  
• d1r3he2 appears in SCOPe 2.07