Lineage for d1r3he2 (1r3h E:5001-5180)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163080Protein Class I MHC homolog [54489] (4 species)
    gamma, delta T-cell ligand
  7. 2163086Species Mouse (Mus musculus), t10 [TaxId:10090] [102839] (1 PDB entry)
  8. 2163089Domain d1r3he2: 1r3h E:5001-5180 [96918]
    Other proteins in same PDB: d1r3ha1, d1r3hb_, d1r3hc1, d1r3hd_, d1r3he1, d1r3hf_, d1r3hg1, d1r3hh_

Details for d1r3he2

PDB Entry: 1r3h (more details), 2.5 Å

PDB Description: Crystal Structure of T10
PDB Compounds: (E:) MHC h2-tl-t10-129

SCOPe Domain Sequences for d1r3he2:

Sequence, based on SEQRES records: (download)

>d1r3he2 d.19.1.1 (E:5001-5180) Class I MHC homolog {Mouse (Mus musculus), t10 [TaxId: 10090]}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeaddweqq
thivtiqgqlsernlmtlvhfynksmddshtlqwlqdcdvepdrhlclwynqlaydsedl
ptlsenpssctvgnstvpqisqhleghcsdvlqkylekgkerll

Sequence, based on observed residues (ATOM records): (download)

>d1r3he2 d.19.1.1 (E:5001-5180) Class I MHC homolog {Mouse (Mus musculus), t10 [TaxId: 10090]}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeaddweqq
thivtiqgqlsernlmtlvhfynksmddshtlqwlqdcdvepdrhlclwynqlaydsedl
ptlsenpssctqhleghcsdvlqkylekgkerll

SCOPe Domain Coordinates for d1r3he2:

Click to download the PDB-style file with coordinates for d1r3he2.
(The format of our PDB-style files is described here.)

Timeline for d1r3he2: