![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class I MHC homolog, alpha-3 domain [88610] (4 species) gamma, delta T-cell ligand |
![]() | Species Mouse (Mus musculus), t10 [TaxId:10090] [101512] (1 PDB entry) |
![]() | Domain d1r3he1: 1r3h E:5181-5273 [96917] Other proteins in same PDB: d1r3ha2, d1r3hb_, d1r3hc2, d1r3hd_, d1r3he2, d1r3hf_, d1r3hg2, d1r3hh_ |
PDB Entry: 1r3h (more details), 2.5 Å
SCOPe Domain Sequences for d1r3he1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r3he1 b.1.1.2 (E:5181-5273) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t10 [TaxId: 10090]} rsdppkahvtrhprpegdvtlrcwalgfypaditltwqkdgeeltqdvefvetrpagdgt fqkwaavvvplgkvqsytchvdheglpepltlr
Timeline for d1r3he1: