Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class I MHC homolog, alpha-3 domain [88610] (4 species) gamma, delta T-cell ligand |
Species Mouse (Mus musculus), t10 [TaxId:10090] [101512] (1 PDB entry) |
Domain d1r3hc1: 1r3h C:3181-3276 [96914] Other proteins in same PDB: d1r3ha2, d1r3hb_, d1r3hc2, d1r3hd_, d1r3he2, d1r3hf_, d1r3hg2, d1r3hh_ |
PDB Entry: 1r3h (more details), 2.5 Å
SCOPe Domain Sequences for d1r3hc1:
Sequence, based on SEQRES records: (download)
>d1r3hc1 b.1.1.2 (C:3181-3276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t10 [TaxId: 10090]} rsdppkahvtrhprpegdvtlrcwalgfypaditltwqkdgeeltqdvefvetrpagdgt fqkwaavvvplgkvqsytchvdheglpepltlrwep
>d1r3hc1 b.1.1.2 (C:3181-3276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t10 [TaxId: 10090]} rsdppkahvtrhprpegdvtlrcwalgfypaditltwqkdgeeltvefvetrpagdgtfq kwaavvvplgkvqsytchvdheglpepltlrwep
Timeline for d1r3hc1: