SCOP 1.69: Domain d1r3hc1: 1r3h C:3181-3276

Lineage for d1r3hc1 (1r3h C:3181-3276)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC homolog, alpha-3 domain [88610] (4 species)
   gamma, delta T-cell ligand

7. Species Mouse (Mus musculus), t10 [TaxId:10090] [101512] (1 PDB entry)

8. Domain d1r3hc1: 1r3h C:3181-3276 [96914]
   Other proteins in same PDB: d1r3ha2, d1r3hb_, d1r3hc2, d1r3hd_, d1r3he2, d1r3hf_, d1r3hg2, d1r3hh_

Details for d1r3hc1

PDB Entry: 1r3h, 2.5 Å

PDB Description: Crystal Structure of T10

SCOP Domain Sequences for d1r3hc1:

Sequence, based on SEQRES records:

>d1r3hc1 b.1.1.2 (C:3181-3276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t10}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqkdgeeltqdvefvetrpagdgt
fqkwaavvvplgkvqsytchvdheglpepltlrwep

Sequence, based on observed residues (ATOM records):

>d1r3hc1 b.1.1.2 (C:3181-3276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t10}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqkdgeeltvefvetrpagdgtfq
kwaavvvplgkvqsytchvdheglpepltlrwep

Timeline for d1r3hc1:

• d1r3hc1 first appeared in SCOP 1.67
  
• d1r3hc1 appears in SCOP 1.71
  
• d1r3hc1 appears in the current release, SCOPe 2.08