Lineage for d1r3hc1 (1r3h C:3181-3276)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746826Protein Class I MHC homolog, alpha-3 domain [88610] (4 species)
    gamma, delta T-cell ligand
  7. 2746832Species Mouse (Mus musculus), t10 [TaxId:10090] [101512] (1 PDB entry)
  8. 2746834Domain d1r3hc1: 1r3h C:3181-3276 [96914]
    Other proteins in same PDB: d1r3ha2, d1r3hb_, d1r3hc2, d1r3hd_, d1r3he2, d1r3hf_, d1r3hg2, d1r3hh_

Details for d1r3hc1

PDB Entry: 1r3h (more details), 2.5 Å

PDB Description: Crystal Structure of T10
PDB Compounds: (C:) MHC h2-tl-t10-129

SCOPe Domain Sequences for d1r3hc1:

Sequence, based on SEQRES records: (download)

>d1r3hc1 b.1.1.2 (C:3181-3276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t10 [TaxId: 10090]}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqkdgeeltqdvefvetrpagdgt
fqkwaavvvplgkvqsytchvdheglpepltlrwep

Sequence, based on observed residues (ATOM records): (download)

>d1r3hc1 b.1.1.2 (C:3181-3276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t10 [TaxId: 10090]}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqkdgeeltvefvetrpagdgtfq
kwaavvvplgkvqsytchvdheglpepltlrwep

SCOPe Domain Coordinates for d1r3hc1:

Click to download the PDB-style file with coordinates for d1r3hc1.
(The format of our PDB-style files is described here.)

Timeline for d1r3hc1: