Lineage for d1r3fa2 (1r3f A:8-250)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 423589Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 423590Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 423596Family d.265.1.2: Pseudouridine synthase II TruB [69746] (1 protein)
    contains C-terminal PUA domain
  6. 423597Protein Pseudouridine synthase II TruB [69747] (3 species)
  7. 423598Species Escherichia coli [TaxId:562] [69748] (2 PDB entries)
  8. 423600Domain d1r3fa2: 1r3f A:8-250 [96910]
    Other proteins in same PDB: d1r3fa1

Details for d1r3fa2

PDB Entry: 1r3f (more details), 1.85 Å

PDB Description: crystal structure of trna pseudouridine synthase trub and its rna complex: rna-protein recognition through a combination of rigid docking and induced fit

SCOP Domain Sequences for d1r3fa2:

Sequence, based on SEQRES records: (download)

>d1r3fa2 d.265.1.2 (A:8-250) Pseudouridine synthase II TruB {Escherichia coli}
grdingvllldkpqgmssndalqkvkriynanraghtgaldplatgmlpiclgeatkfsq
ylldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdieqipsmys
alkyqgkklyeyarqgievprearpitvyellfirhegneleleihcskgtyirtiiddl
geklgcgahviylrrlavskypvermvtlehlrelveqaeqqdipaaelldpllmpmdsp
asd

Sequence, based on observed residues (ATOM records): (download)

>d1r3fa2 d.265.1.2 (A:8-250) Pseudouridine synthase II TruB {Escherichia coli}
grdingvllldkpqgmssndalqkvkriynanraghtgaldplatgmlpiclgeatkfsq
ylldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdieqipitvy
ellfirhegneleleihcskgtyirtiiddlgeklgcgahviylrrlavskypvermvtl
ehlrelveqaeqqdipaaelldpllmpmdspasd

SCOP Domain Coordinates for d1r3fa2:

Click to download the PDB-style file with coordinates for d1r3fa2.
(The format of our PDB-style files is described here.)

Timeline for d1r3fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r3fa1