SCOPe 2.08: Domain d1r3fa2: 1r3f A:8-250

Lineage for d1r3fa2 (1r3f A:8-250)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
   contains C-terminal PUA domain

6. Protein Pseudouridine synthase II TruB [69747] (5 species)

7. Species Escherichia coli [TaxId:562] [69748] (3 PDB entries)

8. Domain d1r3fa2: 1r3f A:8-250 [96910]
   Other proteins in same PDB: d1r3fa1
   protein/RNA complex

Details for d1r3fa2

PDB Entry: 1r3f, 1.85 Å

PDB Description: crystal structure of trna pseudouridine synthase trub and its rna complex: rna-protein recognition through a combination of rigid docking and induced fit

PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1r3fa2:

Sequence, based on SEQRES records:

>d1r3fa2 d.265.1.2 (A:8-250) Pseudouridine synthase II TruB {Escherichia coli [TaxId: 562]}
grdingvllldkpqgmssndalqkvkriynanraghtgaldplatgmlpiclgeatkfsq
ylldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdieqipsmys
alkyqgkklyeyarqgievprearpitvyellfirhegneleleihcskgtyirtiiddl
geklgcgahviylrrlavskypvermvtlehlrelveqaeqqdipaaelldpllmpmdsp
asd

Sequence, based on observed residues (ATOM records):

>d1r3fa2 d.265.1.2 (A:8-250) Pseudouridine synthase II TruB {Escherichia coli [TaxId: 562]}
grdingvllldkpqgmssndalqkvkriynanraghtgaldplatgmlpiclgeatkfsq
ylldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdieqipitvy
ellfirhegneleleihcskgtyirtiiddlgeklgcgahviylrrlavskypvermvtl
ehlrelveqaeqqdipaaelldpllmpmdspasd

Timeline for d1r3fa2:

• d1r3fa2 first appeared in SCOP 1.67
  
• d1r3fa2 appears in SCOPe 2.07