SCOP 1.67: Domain d1r3fa1: 1r3f A:251-314

Lineage for d1r3fa1 (1r3f A:251-314)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (3 families)

5. Family b.122.1.1: PUA domain [88698] (3 proteins)
   RNA-binding domain

6. Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (3 species)

7. Species Escherichia coli [TaxId:562] [88700] (2 PDB entries)

8. Domain d1r3fa1: 1r3f A:251-314 [96909]
   Other proteins in same PDB: d1r3fa2

Details for d1r3fa1

PDB Entry: 1r3f, 1.85 Å

PDB Description: crystal structure of trna pseudouridine synthase trub and its rna complex: rna-protein recognition through a combination of rigid docking and induced fit

SCOP Domain Sequences for d1r3fa1:

Sequence; same for both SEQRES and ATOM records:

>d1r3fa1 b.122.1.1 (A:251-314) Pseudouridine synthase II TruB, C-terminal domain {Escherichia coli}
ypvvnlpltssvyfkngnpvrtsgapleglvrvtegengkfigmgeiddegrvaprrlvv
eypa

Timeline for d1r3fa1:

• d1r3fa1 is new in SCOP 1.67
  
• d1r3fa1 appears in SCOP 1.69
  
• d1r3fa1 appears in the current release, SCOPe 2.08