Lineage for d1r3fa1 (1r3f A:251-314)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383312Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 383313Superfamily b.122.1: PUA domain-like [88697] (3 families) (S)
  5. 383314Family b.122.1.1: PUA domain [88698] (3 proteins)
    RNA-binding domain
  6. 383328Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (3 species)
  7. 383329Species Escherichia coli [TaxId:562] [88700] (2 PDB entries)
  8. 383331Domain d1r3fa1: 1r3f A:251-314 [96909]
    Other proteins in same PDB: d1r3fa2

Details for d1r3fa1

PDB Entry: 1r3f (more details), 1.85 Å

PDB Description: crystal structure of trna pseudouridine synthase trub and its rna complex: rna-protein recognition through a combination of rigid docking and induced fit

SCOP Domain Sequences for d1r3fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3fa1 b.122.1.1 (A:251-314) Pseudouridine synthase II TruB, C-terminal domain {Escherichia coli}
ypvvnlpltssvyfkngnpvrtsgapleglvrvtegengkfigmgeiddegrvaprrlvv
eypa

SCOP Domain Coordinates for d1r3fa1:

Click to download the PDB-style file with coordinates for d1r3fa1.
(The format of our PDB-style files is described here.)

Timeline for d1r3fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r3fa2