Lineage for d1r3ea1 (1r3e A:238-318)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2076966Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2076967Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2076968Family b.122.1.1: PUA domain [88698] (6 protein domains)
    RNA-binding domain
  6. 2076991Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)
  7. 2077007Species Thermotoga maritima [TaxId:2336] [102023] (4 PDB entries)
  8. 2077008Domain d1r3ea1: 1r3e A:238-318 [96907]
    Other proteins in same PDB: d1r3ea2
    protein/RNA complex

Details for d1r3ea1

PDB Entry: 1r3e (more details), 2.1 Å

PDB Description: Crystal Structure of tRNA Pseudouridine Synthase TruB and Its RNA Complex: RNA-protein Recognition Through a Combination of Rigid Docking and Induced Fit
PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1r3ea1:

Sequence, based on SEQRES records: (download)

>d1r3ea1 b.122.1.1 (A:238-318) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfle
tlrkhernervltlrkvfntr

Sequence, based on observed residues (ATOM records): (download)

>d1r3ea1 b.122.1.1 (A:238-318) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfle
tlrkervltlrkvfntr

SCOPe Domain Coordinates for d1r3ea1:

Click to download the PDB-style file with coordinates for d1r3ea1.
(The format of our PDB-style files is described here.)

Timeline for d1r3ea1: