SCOP 1.73: Domain d1r37b2: 1r37 B:144-313

Lineage for d1r37b2 (1r37 B:144-313)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [82286] (4 PDB entries)

8. Domain d1r37b2: 1r37 B:144-313 [96904]
   Other proteins in same PDB: d1r37a1, d1r37b1
   complexed with etx, nad, zn

Details for d1r37b2

PDB Entry: 1r37, 2.3 Å

PDB Description: Alcohol dehydrogenase from sulfolobus solfataricus complexed with NAD(H) and 2-ethoxyethanol

PDB Compounds: (B:) NAD-dependent alcohol dehydrogenase

SCOP Domain Sequences for d1r37b2:

Sequence; same for both SEQRES and ATOM records:

>d1r37b2 c.2.1.1 (B:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
lnaveaapltcsgittyravrkasldptktllvvgaggglgtmavqiakavsgatiigvd
vreeaveaakragadyvinasmqdplaeirriteskgvdavidlnnsektlsvypkalak
qgkyvmvglfgadlhyhaplitlseiqfvgslvgnqsdflgimrlaeagk

Timeline for d1r37b2:

• d1r37b2 first appeared in SCOP 1.67
  
• d1r37b2 appears in SCOP 1.71
  
• d1r37b2 appears in SCOP 1.75
  
• d1r37b2 appears in the current release, SCOPe 2.08