Lineage for d1r37a1 (1r37 A:1-143,A:314-347)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373088Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 373089Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 373153Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (11 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 373171Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 373175Species Archaeon Sulfolobus solfataricus [TaxId:2287] [82080] (4 PDB entries)
  8. 373184Domain d1r37a1: 1r37 A:1-143,A:314-347 [96901]
    Other proteins in same PDB: d1r37a2, d1r37b2

Details for d1r37a1

PDB Entry: 1r37 (more details), 2.3 Å

PDB Description: Alcohol dehydrogenase from sulfolobus solfataricus complexed with NAD(H) and 2-ethoxyethanol

SCOP Domain Sequences for d1r37a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r37a1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus}
mravrlveigkplslqeigvpkpkgpqvlikveaagvchsdvhmrqgrfgnlrivedlgv
klpvtlgheiagkieevgdevvgyskgdlvavnpwqgegncyycrigeehlcdsprwlgi
nfdgayaeyvivphykymyklrrXvkpmitktmkleeaneaidnlenfkaigrqvlip

SCOP Domain Coordinates for d1r37a1:

Click to download the PDB-style file with coordinates for d1r37a1.
(The format of our PDB-style files is described here.)

Timeline for d1r37a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r37a2