Lineage for d1r31b2 (1r31 B:503-610,B:721-877)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 515236Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
    unusual fold
  4. 515237Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 515238Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 515239Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 515277Species Pseudomonas mevalonii [TaxId:32044] [56546] (5 PDB entries)
  8. 515283Domain d1r31b2: 1r31 B:503-610,B:721-877 [96900]
    Other proteins in same PDB: d1r31a1, d1r31b1

Details for d1r31b2

PDB Entry: 1r31 (more details), 2.1 Å

PDB Description: HMG-CoA reductase from Pseudomonas mevalonii complexed with HMG-CoA

SCOP Domain Sequences for d1r31b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r31b2 d.179.1.1 (B:503-610,B:721-877) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii}
ldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpy
avasnfqingrdvlvplvveepsivaaasymaklaranggfttsssapXrlaraqvritp
qqletaefsgeaviegildayafaavdpyraathnkgimngidplivatgndwraveaga
hayacrsghygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaq
alaeiavavglaqnlgamralategi

SCOP Domain Coordinates for d1r31b2:

Click to download the PDB-style file with coordinates for d1r31b2.
(The format of our PDB-style files is described here.)

Timeline for d1r31b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r31b1