SCOPe 2.05: Domain d1r31b1: 1r31 B:611-720

Lineage for d1r31b1 (1r31 B:611-720)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family)

5. Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)

6. Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)

7. Species Pseudomonas mevalonii [TaxId:32044] [55039] (11 PDB entries)
   Uniprot P13702 4-377

8. Domain d1r31b1: 1r31 B:611-720 [96899]
   Other proteins in same PDB: d1r31a2, d1r31b2
   complexed with coa, mev, so4

Details for d1r31b1

PDB Entry: 1r31, 2.1 Å

PDB Description: HMG-CoA reductase from Pseudomonas mevalonii complexed with HMG-CoA

PDB Compounds: (B:) 3-hydroxy-3-methylglutaryl-coenzyme A reductase

SCOPe Domain Sequences for d1r31b1:

Sequence; same for both SEQRES and ATOM records:

>d1r31b1 d.58.20.1 (B:611-720) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl

Timeline for d1r31b1:

• d1r31b1 first appeared in SCOP 1.67
  
• d1r31b1 appears in SCOPe 2.04
  
• d1r31b1 appears in SCOPe 2.06
  
• d1r31b1 appears in the current release, SCOPe 2.08