![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.28: Radical SAM enzymes [102114] (3 families) ![]() common Fe-S cluster and SAM binding sites are embedded into complete or incomplete beta/alpha-barrel |
![]() | Family c.1.28.1: Biotin synthase [102115] (1 protein) regular (beta/alpha)8 barrel |
![]() | Protein Biotin synthase [102116] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102117] (1 PDB entry) |
![]() | Domain d1r30b_: 1r30 B: [96896] complexed with dtb, fes, sam, sf4, trs |
PDB Entry: 1r30 (more details), 3.4 Å
SCOPe Domain Sequences for d1r30b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r30b_ c.1.28.1 (B:) Biotin synthase {Escherichia coli [TaxId: 562]} hrprwtlsqvtelfekplldllfeaqqvhrqhfdprqvqvstllsiktgacpedckycpq ssryktgleaerlmeveqvlesarkakaagstrfcmgaawknpherdmpyleqmvqgvka mgleacmtlgtlsesqaqrlanagldyynhnldtspefygniittrtyqerldtlekvrd agikvcsggivglgetvkdraglllqlanlptppesvpinmlvkvkgtpladnddvdafd firtiavarimmptsyvrlsagreqmneqtqamcfmagansifygckllttpnpeedkdl qlfrklglnpqqt
Timeline for d1r30b_: