Lineage for d1r30a_ (1r30 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2449268Superfamily c.1.28: Radical SAM enzymes [102114] (3 families) (S)
    common Fe-S cluster and SAM binding sites are embedded into complete or incomplete beta/alpha-barrel
  5. 2449269Family c.1.28.1: Biotin synthase [102115] (1 protein)
    regular (beta/alpha)8 barrel
  6. 2449270Protein Biotin synthase [102116] (1 species)
  7. 2449271Species Escherichia coli [TaxId:562] [102117] (1 PDB entry)
  8. 2449272Domain d1r30a_: 1r30 A: [96895]
    complexed with dtb, fes, sam, sf4, trs

Details for d1r30a_

PDB Entry: 1r30 (more details), 3.4 Å

PDB Description: the crystal structure of biotin synthase, an s-adenosylmethionine- dependent radical enzyme
PDB Compounds: (A:) Biotin synthase

SCOPe Domain Sequences for d1r30a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]}
rprwtlsqvtelfekplldllfeaqqvhrqhfdprqvqvstllsiktgacpedckycpqs
sryktgleaerlmeveqvlesarkakaagstrfcmgaawknpherdmpyleqmvqgvkam
gleacmtlgtlsesqaqrlanagldyynhnldtspefygniittrtyqerldtlekvrda
gikvcsggivglgetvkdraglllqlanlptppesvpinmlvkvkgtpladnddvdafdf
irtiavarimmptsyvrlsagreqmneqtqamcfmagansifygckllttpnpeedkdlq
lfrklglnpqqt

SCOPe Domain Coordinates for d1r30a_:

Click to download the PDB-style file with coordinates for d1r30a_.
(The format of our PDB-style files is described here.)

Timeline for d1r30a_: