Class g: Small proteins [56992] (85 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) |
Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins) |
Protein DNA repair protein MutM (Fpg) [81622] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81613] (9 PDB entries) |
Domain d1r2za3: 1r2z A:229-274 [96894] Other proteins in same PDB: d1r2za1, d1r2za2 bound to 5,6-Dihydrouracil (DhU) containing DNA complexed with dhu, zn; mutant |
PDB Entry: 1r2z (more details), 1.63 Å
SCOP Domain Sequences for d1r2za3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r2za3 g.39.1.8 (A:229-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} qgeagtfqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr
Timeline for d1r2za3: