Lineage for d1r2za2 (1r2z A:2-134)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821188Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2821189Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) (S)
    automatically mapped to Pfam PF01149
  5. 2821190Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)
  6. 2821191Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 2821192Species Bacillus stearothermophilus [TaxId:1422] [81612] (23 PDB entries)
  8. 2821193Domain d1r2za2: 1r2z A:2-134 [96893]
    Other proteins in same PDB: d1r2za1, d1r2za3
    bound to 5,6-Dihydrouracil (DhU) containing DNA
    protein/DNA complex; complexed with zn

Details for d1r2za2

PDB Entry: 1r2z (more details), 1.63 Å

PDB Description: MutM (Fpg) bound to 5,6-dihydrouracil (DHU) containing DNA
PDB Compounds: (A:) MutM

SCOPe Domain Sequences for d1r2za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2za2 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
pqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplael

SCOPe Domain Coordinates for d1r2za2:

Click to download the PDB-style file with coordinates for d1r2za2.
(The format of our PDB-style files is described here.)

Timeline for d1r2za2: