SCOP 1.73: Domain d1r2za1: 1r2z A:135-228

Lineage for d1r2za1 (1r2z A:135-228)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (3 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
   contains 4 helices in the core

6. Protein DNA repair protein MutM (Fpg) [81620] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [81611] (9 PDB entries)

8. Domain d1r2za1: 1r2z A:135-228 [96892]
   Other proteins in same PDB: d1r2za2, d1r2za3
   bound to 5,6-Dihydrouracil (DhU) containing DNA
   complexed with dhu, zn; mutant

Details for d1r2za1

PDB Entry: 1r2z, 1.63 Å

PDB Description: MutM (Fpg) bound to 5,6-dihydrouracil (DHU) containing DNA

PDB Compounds: (A:) MutM

SCOP Domain Sequences for d1r2za1:

Sequence; same for both SEQRES and ATOM records:

>d1r2za1 a.156.1.2 (A:135-228) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
gpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdeslfragilpgrpaas
lsskeierlheemvatigeavmkggstvrtyvnt

Timeline for d1r2za1:

• d1r2za1 first appeared in SCOP 1.67
  
• d1r2za1 appears in SCOP 1.71
  
• d1r2za1 appears in SCOP 1.75
  
• d1r2za1 appears in the current release, SCOPe 2.08