Class i: Low resolution protein structures [58117] (24 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (3 species) |
Species Escherichia coli [TaxId:562] [58123] (29 PDB entries) |
Domain d1r2xa_: 1r2x A: [96887] |
PDB Entry: 1r2x (more details), 9 Å
SCOP Domain Sequences for d1r2xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r2xa_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli} iklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksftf iikteppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki iegtaksmgievv
Timeline for d1r2xa_: