Lineage for d1r2xa_ (1r2x A:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 526324Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 526325Protein 70S ribosome functional complex [58121] (3 species)
  7. 526374Species Escherichia coli [TaxId:562] [58123] (29 PDB entries)
  8. 526382Domain d1r2xa_: 1r2x A: [96887]

Details for d1r2xa_

PDB Entry: 1r2x (more details), 9 Å

PDB Description: Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of EF-Tu ternary complex (GDP.Kirromycin) bound 70S ribosome

SCOP Domain Sequences for d1r2xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2xa_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli}
iklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksftf
iikteppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

SCOP Domain Coordinates for d1r2xa_:

Click to download the PDB-style file with coordinates for d1r2xa_.
(The format of our PDB-style files is described here.)

Timeline for d1r2xa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r2xc_