Lineage for d1r2wa_ (1r2w A:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1069596Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1069652Domain d1r2wa_: 1r2w A: [96885]
    L11 with 58nts of 23s rRNA fitted into the cryo-em map of the 70S ribosome
    protein/RNA complex

Details for d1r2wa_

PDB Entry: 1r2w (more details), 9 Å

PDB Description: Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of the 70S ribosome
PDB Compounds: (A:) 50S ribosomal protein L11

SCOPe Domain Sequences for d1r2wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2wa_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiikteppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamk
iiegtaksmgievv

SCOPe Domain Coordinates for d1r2wa_:

Click to download the PDB-style file with coordinates for d1r2wa_.
(The format of our PDB-style files is described here.)

Timeline for d1r2wa_: