SCOP 1.67: Domain d1r2wa_: 1r2w A:

Lineage for d1r2wa_ (1r2w A:)

1. Root: SCOP 1.67

2. Class i: Low resolution protein structures [58117] (22 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (2 species)

7. Species Escherichia coli [TaxId:562] [58123] (27 PDB entries)

8. Domain d1r2wa_: 1r2w A: [96885]

Details for d1r2wa_

PDB Entry: 1r2w, 9 Å

PDB Description: Coordinates of L11 with 58nts of 23S rRNA fitted into the cryo-EM map of the 70S ribosome

SCOP Domain Sequences for d1r2wa_:

Sequence; same for both SEQRES and ATOM records:

>d1r2wa_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiikteppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamk
iiegtaksmgievv

Timeline for d1r2wa_:

• d1r2wa_ is new in SCOP 1.67
  
• d1r2wa_ appears in SCOP 1.69
  
• d1r2wa_ appears in the current release, SCOPe 2.08