Lineage for d1r2rb_ (1r2r B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 383643Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 383644Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 383645Protein Triosephosphate isomerase [51353] (16 species)
  7. 383728Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [102035] (3 PDB entries)
  8. 383730Domain d1r2rb_: 1r2r B: [96876]

Details for d1r2rb_

PDB Entry: 1r2r (more details), 1.5 Å

PDB Description: crystal structure of rabbit muscle triosephosphate isomerase
PDB Compounds: (B:)

SCOP Domain Sequences for d1r2rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2rb_ c.1.1.1 (B:) Triosephosphate isomerase {Rabbit (Oryctolagus cuniculus)}
psrkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkiav
aaqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalsegl
gviacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqa
qevheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefv
diinakq

SCOP Domain Coordinates for d1r2rb_:

Click to download the PDB-style file with coordinates for d1r2rb_.
(The format of our PDB-style files is described here.)

Timeline for d1r2rb_: