![]() | Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
![]() | Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
![]() | Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families) ![]() |
![]() | Family f.13.1.1: Bacteriorhodopsin-like [81319] (4 proteins) |
![]() | Protein Bacteriorhodopsin [56871] (2 species) a light-driven proton pump |
![]() | Species Archaeon Halobacterium salinarum [TaxId:2242] [56873] (50 PDB entries) |
![]() | Domain d1r2na_: 1r2n A: [96873] complexed with ret |
PDB Entry: 1r2n (more details)
SCOP Domain Sequences for d1r2na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r2na_ f.13.1.1 (A:) Bacteriorhodopsin {Archaeon Halobacterium salinarum} qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge
Timeline for d1r2na_: