Lineage for d1r2na_ (1r2n A:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 425814Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 425815Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families) (S)
  5. 425816Family f.13.1.1: Bacteriorhodopsin-like [81319] (4 proteins)
  6. 425821Protein Bacteriorhodopsin [56871] (2 species)
    a light-driven proton pump
  7. 425826Species Archaeon Halobacterium salinarum [TaxId:2242] [56873] (50 PDB entries)
  8. 425889Domain d1r2na_: 1r2n A: [96873]
    complexed with ret

Details for d1r2na_

PDB Entry: 1r2n (more details)

PDB Description: nmr structure of the all-trans retinal in dark-adapted bacteriorhodopsin

SCOP Domain Sequences for d1r2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2na_ f.13.1.1 (A:) Bacteriorhodopsin {Archaeon Halobacterium salinarum}
qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge

SCOP Domain Coordinates for d1r2na_:

Click to download the PDB-style file with coordinates for d1r2na_.
(The format of our PDB-style files is described here.)

Timeline for d1r2na_: