Class b: All beta proteins [48724] (180 folds) |
Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily) core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection |
Superfamily b.138.1: Hydrophobin II, HfbII [101751] (2 families) automatically mapped to Pfam PF06766 |
Family b.138.1.1: Hydrophobin II, HfbII [101752] (2 proteins) a self-assembling amphiphile |
Protein Hydrophobin II, HfbII [101753] (1 species) |
Species Trichoderma reesei [TaxId:51453] [101754] (5 PDB entries) |
Domain d1r2mb_: 1r2m B: [96872] complexed with mn |
PDB Entry: 1r2m (more details), 1 Å
SCOPe Domain Sequences for d1r2mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r2mb_ b.138.1.1 (B:) Hydrophobin II, HfbII {Trichoderma reesei [TaxId: 51453]} avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq allcqkaigt
Timeline for d1r2mb_: